SILu (TM) Lite interférence IFNG Gamma hum

Code: msst0040-50ug D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

SILuLite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed...


en savoir plus

Votre prix
£642.00 50UG
£770.40 inc. VAT

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

SILuLite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

General description

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Immunogen

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Physical form

Lyophilized from a solution of phosphate buffered saline.

assay≥98% (SDS-PAGE)
biological sourcehuman
formlyophilized powder
Gene Informationhuman ... IFNG(3458)
mol wtcalculated mol wt 17 kDa
potency≥98% Heavy amino acids incorporation efficiency by MS
Quality Level200
recombinantexpressed in HEK 293 cells
storage temp.−20°C
suitabilitysuitable for mass spectrometry (internal calibrator)
technique(s)mass spectrometry (MS): suitable
UniProt accession no.P01579
Ce produit répond aux critères suivants: