Calmodulin bovine, recombinant, expressed in E. coli, lyophilized powder, >=98% (SDS-PAGE)

Code: c4874-0.2mg D2-231

Not available outside of the UK & Ireland.

Application

Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease ...


read more

Your Price
£95.90 0.2MG

Not available outside of the UK & Ireland.

Application

Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease Glu-C proteolysis and deamidation studies.

Biochem/physiol Actions

Ca2+ binding protein that is required for activation of cyclic nucleotide-dependent phosphodiesterase. It is also a cofactor/activator of nitric oxide synthase, calcineurin, and many kinases including ATPase, myosin light chain kinase, and CAM kinase I, II, and III. It mediates ryanodine receptor activation by cyclic ADP-ribose and is involved in intracellular Ca2+ homeostasis.

Calmodulin from bovine undergoes conformational changes upon calcium binding. It binds to sphingosylphosphorylcholine and inhibit calcineurin and phosphodiesterase enzymes.

General description

Calmodulin from bovine takes up a dumb-bell-structure. Two calciumbinding EF hand loops, antiparallel β-sheet and three α-helices comprises a lobe. It has a central helix connecting the lobes. Calmodulin can bind four calcium molecules in a cooperative interaction pattern.

Physical properties

Sequence:MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Preparation Note

Produced using animal component-free materials.

assay≥98% (SDS-PAGE)
biological sourcebovine
compositionProtein, ≥85%
formlyophilized powder
Gene Informationbovine ... CALM(100297344)
mol wtMw 19000.9 by amino acid sequence
Quality Level200
recombinantexpressed in E. coli
storage temp.−20°C
UniProt accession no.P62157
Code
Description
Unit Size
List Price
Qty
C4874-0.5MG
Unit:EACH
List Price: £192.00
Source:List Price
ADD
Cas Number77107-46-1
This product has met the following criteria: