Not available outside of the UK & Ireland.
Biochem/physiol Actions
SILu™Lite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
General description
Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.
Immunogen
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
Physical form
Lyophilized from a solution of phosphate buffered saline.
This product has met the following criteria: