Not available outside of the UK & Ireland.

Biochem/physiol Actions

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).

General description

SILu^™Lite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILu^™Lite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Physical form

Supplied as a lyophilized powder containing tris buffered saline and methionine.

Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA